SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012790088.1.2976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012790088.1.2976
Domain Number 1 Region: 542-947
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 6.43e-31
Family alpha-mannosidase, C-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 123-316
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.00000000000578
Family alpha-mannosidase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012790088.1.2976
Sequence length 969
Comment glycoside hydrolase [Chitinophaga pinensis]; AA=GCF_000024005.1; RF=representative genome; TAX=485918; STAX=79329; NAME=Chitinophaga pinensis DSM 2588; strain=DSM 2588; AL=Complete Genome; RT=Major
Sequence
MYIHIMNRLKRWYTDKYCLLLLAVMTIDLAHAQQTPAFTSIALQPTVAYLKHQGRAARMV
RLLFHGGNSYAPAMAYMTFNGLYDSIPLVATEKGIDIFELPLPGGPVHHETQLYVKVKSG
GREYTARCMVAPAPEWKVYLLPHSHVDIGYTNVQEKVMQLHMNNIDEAIKIAERTQNYPP
DARYKWNTEAFWVVDHYLAAADEAKKKAFWEAVKKGWINIDGAYANINTSVTDSRQLMQM
FYTAVKTAKDHGLDINTMFQGDVPGASWGLASQSGITGIRYFWGAPNADDRIGQSPAWRD
RPFYWQSPGQQKMLYWQSEPYSIGYRLKGSKIPNFFTVEDPVPYYTGHPSENFLNPYLFD
YLAALDKKKFPYNMTIMTWAMSDNAPIDPELPEAVKAWNERYASPRLVITSVKQFFNDFE
AAYADRIPVVSGDYTEFWTDGIASAARETGYNRNASETLQQADAVWALRGKADYPATAID
TIWNNILLFNEHTWGAYNSISNPEDPKVISQWGYKQSFALKGHAQSAAMLTSATGGEAIA
NAVDVYNTIGENRTELVRIPAAQSTAGDLVKDVNGKKVPSQRLSTGELAILVQHIAPYAK
QRFTIQAGKAYSNTKSVVSNTTLQNELYKISLNAQTGNIDKLERSGIPHNLADSGGLNRY
SYLPGDSLEHIAYAGPATITVKEKGPLVVSVIVTAVAPGANELTTEIMLVAGEDRVQIIN
NIDKKAITKKEGVHFGFPFNVADAQVRYSIPWGSINVEADQLQYANRNWYTVQHWVDVSN
KDYGVTWSTPDAPLFEVGAQTTAGLTGGLHDSPKWISFTEQHPAIYSWIMNNLWHTNFRH
AQEGPTTFRYYLTVHHSYDAYAANQQGLANHRPLIAAPASGPATESLPFTINSKAVYVES
LKPAADGKGVIVWLVNTAPVETGVSFNTKSNAAKLQITATNMLEEYKQSLDNNIILPAKG
VMMVRVENK
Download sequence
Identical sequences C7PHH6
WP_012790088.1.2976 gi|256421460|ref|YP_003122113.1| 485918.Cpin_2421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]