SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012794023.1.2976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012794023.1.2976
Domain Number 1 Region: 72-390
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.51e-87
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012794023.1.2976
Sequence length 392
Comment proline dehydrogenase [Chitinophaga pinensis]; AA=GCF_000024005.1; RF=representative genome; TAX=485918; STAX=79329; NAME=Chitinophaga pinensis DSM 2588; strain=DSM 2588; AL=Complete Genome; RT=Major
Sequence
MEKQLSLSFENTAIAFESKTDKALKKADFLFTNIGKPWLVKVGAAVTPFALKIGLPIKGL
IRSTIFSQFCGGENLQEAAATASSLGKFHVGVALDYGVEAMEGEENYDHAVPEFVRAIEY
AAGNPNIPFIAIKVTGFARFSLLEKLHANETLTPEEAAEYARVRQRIQTIAATAAKHKVG
LLIDAEESWIQQPVDDLTEELMAQFNTTNAIVYNTFQMYRHDRLAFLKRSFEKAQQQGYL
LGAKLVRGAYMEKERKRAEEMGYPSPIQPDKEATDRDYNAAVTFCMERLDKLAVFVGTHN
EQSSMLAASLLHQQELPHNHPHVSFSQLLGMSDNITFNLAHAGYHVSKYLPYGPVKDVMP
YLLRRAQENTSISGQVGRELGLIRKERKRRGI
Download sequence
Identical sequences C7PKU9
WP_012794023.1.2976 485918.Cpin_6455 gi|256425407|ref|YP_003126060.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]