SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012801494.1.62203 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_012801494.1.62203
Domain Number - Region: 19-117
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 0.0144
Family Helical scaffold and wing domains of SecA 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012801494.1.62203
Sequence length 133
Comment hypothetical protein [Cyanothece sp. PCC 8802]; AA=GCF_000024045.1; RF=na; TAX=395962; STAX=395962; NAME=Cyanothece sp. PCC 8802; strain=PCC 8802; AL=Complete Genome; RT=Major
Sequence
MPTIKIQAQLSKEDLFQAVQQLSLSELEGFVQDIIALKAKQKAPSLSTDETELLLKINQG
LSSDIQTRYQLLIQKRNDETLTEPEYQELLQLTDKVELHQAQRLDYLAQLAQLRQISLTD
LMTQLGIKPTIND
Download sequence
Identical sequences gi|256823874|ref|YP_003147836.1| WP_012801494.1.62203 395962.Cyan8802_4620 gi|256823874|ref|YP_003147836.1|NC_013167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]