SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012805224.1.63071 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_012805224.1.63071
Domain Number - Region: 106-134
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00932
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012805224.1.63071
Sequence length 172
Comment hypothetical protein [Desulfomicrobium baculatum]; AA=GCF_000023225.1; RF=representative genome; TAX=525897; STAX=899; NAME=Desulfomicrobium baculatum DSM 4028; strain=DSM 4028; AL=Complete Genome; RT=Major
Sequence
MEKLPSSPVGLHHAQTGHFWPEPESSDFLRVVEFAGFQVPEDGLVLAPPYGGELTVWPDG
QYTFVCPVSGDGGQSMVATHYSYIVEAMDGSTSFGTFALGEQAPEETMPDFQSWSMDDIL
ALEDVVGLSVNAHGPVAEFMGVDAGADLDLSGEAGGFSVDVLEQMIKTSCES
Download sequence
Identical sequences C7LRT3
gi|256827827|ref|YP_003156555.1| 525897.Dbac_0009 WP_012805224.1.63071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]