SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012806362.1.20655 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012806362.1.20655
Domain Number 1 Region: 83-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 2.22e-36
Family Ribosomal protein L6 0.00004
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 2.62e-26
Family Ribosomal protein L6 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012806362.1.20655
Sequence length 177
Comment 50S ribosomal protein L6 [Leptotrichia buccalis]; AA=GCF_000023905.1; RF=representative genome; TAX=523794; STAX=40542; NAME=Leptotrichia buccalis C-1013-b; strain=DSM 1135; AL=Complete Genome; RT=Major
Sequence
MSRIGKKPITIPAGVEIKQEGNTFTVKGPKGQLVRELSSEIKVNIDGSEITIERPNDLPN
IRALHGTTRANLNNMIVGVSEGFTRGLELVGVGYRVQASGKGLTLSLGYSHPVEVEAVEG
ITFKVEGNTKISVEGIDKQLVGQVAANIRAKRPPEPYKGKGVKYADEVIRRKEGKKG
Download sequence
Identical sequences C7NDL2
gi|257125051|ref|YP_003163165.1| WP_012806362.1.20655 523794.Lebu_0254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]