SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012812806.1.88241 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012812806.1.88241
Domain Number 1 Region: 41-347
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.92e-91
Family Phosphate binding protein-like 0.000000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012812806.1.88241
Sequence length 348
Comment phosphate ABC transporter substrate-binding protein PstS [Acetobacter pasteurianus]; AA=GCF_000010945.1; RF=na; TAX=634458; STAX=438; NAME=Acetobacter pasteurianus IFO 3283-01-42C; strain=IFO 3283 substr. IFO 3283-01-42C; AL=Complete Genome; RT=Major
Sequence
MKEKRIMVGRAKMMSWKKTVALSALLCGLAGAVLPQAQAEQITGAGSSFAAPLYQSWSAH
SAAQTGVQLNYQTIGSGAGQNQVLAGTVDFGASDAPMSHARLDAGHLLQFPTAIGGIVVI
ANVPGVPEGALRLTGPVLAAIYDGSITQWNDPRIVALNPGVTLPDLPVAPLHRADGSGTT
YVFTEYLGRVSPTWEKQVGRGTSVAWPVGAGARGNDGIASYVKNTEGSVGYAEYAYAERN
HLSTVVLQNRAGEFVVPSVTSFTRAAENATWDHADMTASLCDADGAGSWPIVTTTYALVP
REANEANHGNAVRTFFRWGVKDGEAVSRELDYVPLPPVVRDAVLERLK
Download sequence
Identical sequences C7JGH4
634452.APA01_10340 gi|384056910|ref|YP_005489577.1| gi|384118919|ref|YP_005501543.1| gi|384050568|ref|YP_005477631.1| gi|384059551|ref|YP_005498679.1| gi|384062843|ref|YP_005483485.1| gi|384042051|ref|YP_005480795.1| WP_012812806.1.36695 WP_012812806.1.45580 WP_012812806.1.55019 WP_012812806.1.65311 WP_012812806.1.71918 WP_012812806.1.88241 WP_012812806.1.96488 WP_012812806.1.99323 gi|384053676|ref|YP_005486770.1| gi|258542130|ref|YP_003187563.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]