SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012823421.1.355 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012823421.1.355
Domain Number 1 Region: 21-253
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.4e-52
Family Extended AAA-ATPase domain 0.000000374
Further Details:      
 
Domain Number 2 Region: 258-331
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.27e-23
Family Helicase DNA-binding domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012823421.1.355
Sequence length 348
Comment Holliday junction branch migration DNA helicase RuvB [Halothiobacillus neapolitanus]; AA=GCF_000024765.1; RF=representative genome; TAX=555778; STAX=927; NAME=Halothiobacillus neapolitanus c2; strain=c2; AL=Complete Genome; RT=Major
Sequence
MTDRVITAESVTEDEAIERALRPKRLVDYVGQPAVVEQMEIFIPAARQRGEALDHVLIFG
PPGLGKTTLANIIAHEMGVGLKQTSGPVLERPGDLAALLTNLEPNDVLFIDEIHRLSAVV
EEILYPAMEDHQIDIMIGEGPAARSIKLDLPPFTLVGATTRAGMLTGPLRDRFGIIQRLE
FYSVADLTRIVSRSAQLMGVSIDAGGAQEIAARARGTPRIANRLLRRVRDFAEVRGNGTV
DQPMANAALDLLQVDARGFDQQDRRLLEALIHKFDGGPVGLDNIAAAIGEARDTIEDVLE
PFLIQQGFLVRTARGRMATRQTYAHFGFRPPSAFESQQGTLLPEEEPQ
Download sequence
Identical sequences D0KY62
WP_012823421.1.355 gi|261855149|ref|YP_003262432.1| 555778.Hneap_0531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]