SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012844843.1.83145 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012844843.1.83145
Domain Number 1 Region: 146-305
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 8.24e-47
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000289
Further Details:      
 
Domain Number 2 Region: 17-144
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.62e-29
Family Duplicated SiR/NiR-like domains 1 and 3 0.0024
Further Details:      
 
Domain Number 3 Region: 397-539
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.44e-25
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00034
Further Details:      
 
Domain Number 4 Region: 278-407
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.45e-22
Family Duplicated SiR/NiR-like domains 1 and 3 0.0025
Further Details:      
 
Domain Number 5 Region: 557-643
Classification Level Classification E-value
Superfamily MoaD/ThiS 0.0000000000000692
Family MoaD 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012844843.1.83145
Sequence length 643
Comment ferredoxin--nitrite reductase [Rhodothermus marinus]; AA=GCF_000024845.1; RF=representative genome; TAX=518766; STAX=29549; NAME=Rhodothermus marinus DSM 4252; strain=DSM 4252; AL=Complete Genome; RT=Major
Sequence
MSETKTFVRYGRRAQELNWELVLKRNSIERLKQERPPLRVVEELPELIERGYEAIPEEDI
VRLYWYGIAHDKPKVGTFMVRLKVPGGLLRPDQLRAIGEIAGRYGRDYGELTTRQGIQLH
WVAMDKLPEVLEAIGRAGLTTVGAEGDTVRNITSCPVNGINPDELFDVRPVIEEAARFFW
GNPDYSNLPRKHKFTISSCPHQCNAPEIHDIALIGVIKDGRPGFAVKVGGGLSATPRLAR
DLGVFVPVNEAVEVLAAITDVWQDNLRYRLSRAKSRIKFLVDDYGPEGVREMVEERLGRK
LEDFRAPDPVPGGNHLGIHRQKQEGFYYAGFPVPSGRVTGTQLRQIADILEDVGGDIRFT
REQNFILGNIPEDRLDRVLDQMRAVGFPIERHRLYGTSTACTSHQFCNYSVAETKEKLDE
IIAELEAHFGDEVQDLTIYMDGCPHACAHHWVGDIGLQGTRTAGPNGTKIEAYDVTLRGG
LGVHAAIGRPILRRIPSEEISQAIVRLVGAWLQERRRLGDHYTFQAFCEAHTNEELQAIA
LGEVTAEEVEAADVALIRIPGPLLELTDGSDVIEVRAPTVRVALEQAGRRYPRLKETVLT
PDGQVNEAFNLYVNEEDIQGLQGLDTPLKPGDELLILMAMSGG
Download sequence
Identical sequences D0MEK5
gi|268317902|ref|YP_003291621.1| 518766.Rmar_2355 WP_012844843.1.83145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]