SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012848618.1.32191 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012848618.1.32191
Domain Number 1 Region: 794-1164
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.37e-114
Family PFOR PP module 0.0000000304
Further Details:      
 
Domain Number 2 Region: 2-254
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.02e-72
Family PFOR Pyr module 0.000000107
Further Details:      
 
Domain Number 3 Region: 417-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.22e-67
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000173
Further Details:      
 
Domain Number 4 Region: 256-408
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 7.71e-41
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000223
Further Details:      
 
Domain Number 5 Region: 665-839
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3.77e-20
Family Ferredoxin domains from multidomain proteins 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012848618.1.32191
Sequence length 1176
Comment MULTISPECIES: pyruvate:ferredoxin (flavodoxin) oxidoreductase [Edwardsiella]; AA=GCF_002075835.1; RF=na; TAX=1263550; STAX=1263550; NAME=Edwardsiella piscicida; strain=ETW41; AL=Chromosome; RT=Major
Sequence
MITIDGNSAVASVAYRASEVIAIYPITPSSGMAEQASAWSADGRPNVWGDIPRVVEMQSE
GGAIAAVHGALQTGALATSFTSSQGLLLMIPTLYKLAGELTPFVLHVAARTVATHALSIF
GDHSDVMAVRQTGCAMLCAASVQEAQDFALIAHIASLNSRLPFIHFFDGFRTSHEINKIV
PLADDTLQTLLPAQAIAAHRAHALTPEHPVIRGTSANPDTYFQAREASNPWYDAAYDHVA
DAMQAFADQCGRRYQPFEYDGDPEATRVIVVMGSACGTCAEVCDMLRARGEKVGVLKVRL
YRPFSARHLLAALPLSAQRIAVLDRTKEPGALGEPLYLDVIAALAQAVSSGERAALPLTI
GGRYGLSSKEFGPDCALAVFEALETPRPRPRFTVGINDDVTHLSLPRRTDVHPVSNRLEA
LFYGLGSDGTVSAAKNNIKIIGNSTPLHAQGYFVYDSKKAGGLTVSHLRVRETPIHSAYL
VEQADFIGCHQWQFIERYQMVERLRLGGIFLLNTPYAADEAWARLPQEVQALLNARQAKF
YVINAARIARECRLGARINTVMQMAFLHLSDLIPNGGALPLLQDAIARSYANKGQEIVER
NWQALGAVEGALHAVPLRPVDAESPRRPPIVADQAPDFVKTVTAAMLAGLGDSLPVSAFP
PDGTWPVGTTRWEKRNIAEAIPIWQPALCTQCNHCVAACPHAAIRAKVVAPAALEHAPAT
LESLEVRARDLRGERYVLQVAPEDCTGCNLCVTVCPAADRQDPSVKAINMQPRLAHLARE
KAHYDAFLALPEIDRRRLERIDIRTSQLISPLFEYSGACSGCGETPYIKLLTQLFGDRML
IANATGCSSIYGGNLPTSPYTTDAQGRGPAWANSLFEDNAEFGLGFRLSAQQHRQRALRL
LHALAGQLPEALVAALQQEETPTETRRQQIAALRAALATLDDPQAQALAQTADALVEQSI
WLIGGDGWAYDIGFGGLDHVLSLSENVNVLVLDTQCYSNTGGQQSKATPLAAVTKFGEHG
KRKARKDLGVSMMMYGHVYVAQISLGAQLNQTVKALQEAESYPGPSLVIAYSPCEEHGYD
LADSHEQMKRLTANGFWPLYRFDPRRGAEGQNALALDSRPPSGDLAQTLLAEQRFRRLNS
LAPQEAQTLYREAEENLRQRFALLSLLAGKTPPATE
Download sequence
Identical sequences A0A0H3DQQ8 A0A146JLV5 A0A1D7V8J5 D0Z846
498217.ETAE_1778 WP_012848618.1.32191 WP_012848618.1.79796 WP_012848618.1.82304 WP_012848618.1.83294 WP_012848618.1.91532 WP_012848618.1.93598 gi|387867738|ref|YP_005699207.1| gi|269139125|ref|YP_003295826.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]