SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012860601.1.35130 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012860601.1.35130
Domain Number 1 Region: 119-296,427-581
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.9e-101
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000102
Further Details:      
 
Domain Number 2 Region: 293-422
Classification Level Classification E-value
Superfamily GAD domain-like 4.74e-35
Family GAD domain 0.0004
Further Details:      
 
Domain Number 3 Region: 1-110
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.86e-28
Family Anticodon-binding domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012860601.1.35130
Sequence length 597
Comment aspartate--tRNA ligase [Sebaldella termitidis]; AA=GCF_000024405.1; RF=representative genome; TAX=526218; STAX=826; NAME=Sebaldella termitidis ATCC 33386; strain=ATCC 33386; AL=Complete Genome; RT=Major
Sequence
MYRTHNLGQLRIENAGEEVVLSGWVANVRDMNHFLFLVLRDREGITQVIIDKENSPEGLF
EKVKALNNEDVVRVTGTVRERSSKNKDMPTGDIEVAADTVDILSRSLQLPFAINDNITNL
SEDMRLKYRYLDLRRTKMLNNLKKRNTMLKAIRDYLTDKGFLDIDTPVLAKATPEGARDF
IVPSRINKGDFYALPQSPQLFKQILMVAGVDKYYQLAKCFRDEDLRADRQPEFTQLDIEM
SFVTQEDILCEMEKMAKKVFEKVTGKKADYDFPRMDYYEAMDRYGSDKPDTRFGLELIDI
TEEVRNSGFKAFAGAAESGGSIKAIVVPGNLEKFSRKYIGDLENYVKTYYKAKGLAHIRI
DENNETVSPIAKFFSEAELSAITGKLELKAGSIALIIADTKDVTNNALGALRLKVGNELD
FINEEQDNFLWVIDFPMFEWSEEEERYKSTHHPFTAIKEEDKEFLNKNLEKIRTLSYDMV
LNGYEIGGGSIRIHDSELQDVIFEKLGLSKEEAEEKFGFFLNALRYGVPPHGGIAFGVDR
WLMAMLKEDSIKEVIPFPKTNKGQDLMMEAPAAVDKKQLEEELLLKSLYVEEAKEDK
Download sequence
Identical sequences D1AFX0
WP_012860601.1.35130 gi|269119759|ref|YP_003307936.1| 526218.Sterm_1137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]