SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012861480.1.35130 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012861480.1.35130
Domain Number 1 Region: 116-419
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.52e-101
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000582
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily tRNA-binding arm 3.09e-28
Family Seryl-tRNA synthetase (SerRS) 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012861480.1.35130
Sequence length 423
Comment serine--tRNA ligase [Sebaldella termitidis]; AA=GCF_000024405.1; RF=representative genome; TAX=526218; STAX=826; NAME=Sebaldella termitidis ATCC 33386; strain=ATCC 33386; AL=Complete Genome; RT=Major
Sequence
MIDMKFIRENTEIIRKSLKDRNSNFDLDGLLKADEARRELLQEAETLKKEKNDQSALIGK
YKREGKNADELLEKMGKVSDKIKELDEKTAKIEEEQNYLLLTIPNKLHESTPVGASEDDN
VEVRKWGEPKKFGFEPKPHEELGTELGILDFERGVKLSGSRFTVYKGMAAKLERALINFM
LDLHTSEHGYEEMLTPQLVKRDIMVGTGQLPKFEDDAYKTTDDMFLIPTAEVTLTNLHKD
EILAESELPKYYCGFTACFRREAGSHGKDMKGILRQHQFNKVEMVKIVHPENSYDELEKM
VNNAETVLQKLNIPYRVLALCSGDIGFGASKTYDLEVWIPSQNKYREISSCSNTEDFQAR
RAMIKYRSETDKKSYFVHTLNGSGLAVGRTLLAIMENYQKEDGSIEIPEVLIPYMGGITE
IKK
Download sequence
Identical sequences D1AJJ8
526218.Sterm_2031 WP_012861480.1.35130 gi|269120640|ref|YP_003308817.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]