SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012874013.1.85100 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012874013.1.85100
Domain Number 1 Region: 140-422
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.12e-128
Family Enolase 0.0000000436
Further Details:      
 
Domain Number 2 Region: 3-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.05e-52
Family Enolase N-terminal domain-like 0.00000422
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012874013.1.85100
Sequence length 431
Comment phosphopyruvate hydratase [Thermobaculum terrenum]; AA=GCF_000025005.1; RF=representative genome; TAX=525904; STAX=166501; NAME=Thermobaculum terrenum ATCC BAA-798; strain=ATCC BAA-798; AL=Complete Genome; RT=Major
Sequence
MAVIDDVYALEILDSRGNPTIQVTVVLDSGAYGTAAVPSGASTGAHEAIELRDKDPIRFG
GKGVLKAVSNVNEIIAETILGENVNSQRELDQILLELDGTPNKSNLGANAILGVSLAFAH
AMAADLNLPLYMYLGGAIARTLPVPMMNILNGGKHADNSTDMQEFMIMPIGASSFSEALR
WGSEVYHALKKDLDNRGFNTNIGDEGGFAPSLDSNKTAIEAILRAIENAGYTPGEQIVIA
LDPAATELYQGGQYHLKKEGEVLTSSEMVDFWQEWIRQYPIVSIEDGLAEDDWEGWTQLT
EAIGNSVQLVGDDLFVTNTDRIREGIARRAANSVLIKPNQIGTLTETIEAVELAHKAGWT
AIMSHRSGETEDTTIADLAVALGTGQIKTGAPARGERTAKYNRLLRIEHELGDDAIYAGW
SALRRKDLLSR
Download sequence
Identical sequences D1CDH2
525904.Tter_0055 gi|269925177|ref|YP_003321800.1| WP_012874013.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]