SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012875065.1.85100 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012875065.1.85100
Domain Number 1 Region: 278-323
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.000000767
Family MLTA-like 0.0046
Further Details:      
 
Weak hits

Sequence:  WP_012875065.1.85100
Domain Number - Region: 852-981
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000362
Family Clostridium neurotoxins, the second last domain 0.072
Further Details:      
 
Domain Number - Region: 654-728
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0183
Family CBM4/9 0.043
Further Details:      
 
Domain Number - Region: 492-635
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0221
Family Family 30 carbohydrate binding module, CBM30 (PKD repeat) 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012875065.1.85100
Sequence length 1063
Comment 3D domain-containing protein [Thermobaculum terrenum]; AA=GCF_000025005.1; RF=representative genome; TAX=525904; STAX=166501; NAME=Thermobaculum terrenum ATCC BAA-798; strain=ATCC BAA-798; AL=Complete Genome; RT=Major
Sequence
MHAVMRTVIVLLLLLALVMPISAKMAPTALAEELGGNGSWYRYQGEPSSYDSHSNQNVNC
GPTSVAMAIQYTQNLSVPIRDIRDFIGKNKKSTNLSDLTKALSHWNVAYRADIYNVSDIK
AALQQGHIIIVALDMRAISPGADLNGASADPSIRIGRFESIAREHWIVIKGITPDENYFI
VYDGNVWGGPGNPVYWYSDGTPKGMDRYYAVNEVEKGMRHFGANTIKGIEIISSRLPDRT
LRNTVIAKVTYYTLSPEETGKNPGDPGWGIMRNGKKVHWGAVAVDPNYIPLGTKMLIDGW
EDQIFVASDTGSQVKGWQIDVYWPGSREEALRKNDELGGWRKITFIGMDAPVSTSTTTPP
VNAYINAPETTTTRWINLQLHAEDPEEGVVGMMISNSKNFTDAFEEPYSSIKEWTLPPGD
GEKTVYARFKNSDGAWSSLVEAHIHLEEEPPTGAVTLAPKPGLVSYIPFNGSTMAVIGPQ
PKISGPVRYASMNNNKLSNSSFELWAGGIPKDWDSPLRDESYAAYEPSTEALDGSTSLFS
NSTKEGYIYQIVPVRANTSYTLAIMAKGNNGAIQIQELQTTGTTSRVLKSHTAGFKYASD
WKEIKIKFRTQANTTNALVKLWGKNAYWDDIQLVEGFNPTNYLSEGLLLEGSSRNYIENP
SGELGPEGWSGINSWVDITSTREYTFFGYKALRVRKVKPGPAATIIAANLIPGKTYTLSA
YIKLEDQRPVDSSIIRGWFFEGIDSVDQLDLSQVTDMNRPVMQWEPVGGGWYRGYFTFIA
RHDKGLYGVMSTDRIPVGGIYYMDGVQLEESDNPSTYLDGNSGSGYKWSGKPYRSTSYRE
GTTVIVGELRNSTGTVFFKARSLDSHKTTSNATILKIGQLYIQQRSNQMLFKWGDKLIGS
ASLDTHPNAYAVTWNSLRITVYSNGKEIGSVAARGPRKGRLVEISPSQDTKAIVISEFSL
WKSVLTEENISFLSSHRSIDPGVRFTVDPKTRIWVAAQDPTNKDLRILWSPDGIHWQSWN
KGIGSSPWNIGGSKGLKTVWIKVIDPIGNWMMYKDEIYLGKEG
Download sequence
Identical sequences D1CB65
WP_012875065.1.85100 gi|269926229|ref|YP_003322852.1| 525904.Tter_1114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]