SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012876057.1.85100 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012876057.1.85100
Domain Number 1 Region: 163-396
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 3.66e-47
Family Creatinase/aminopeptidase 0.0000897
Further Details:      
 
Weak hits

Sequence:  WP_012876057.1.85100
Domain Number - Region: 4-159
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 0.000235
Family Creatinase/prolidase N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012876057.1.85100
Sequence length 403
Comment peptidase M24 [Thermobaculum terrenum]; AA=GCF_000025005.1; RF=representative genome; TAX=525904; STAX=166501; NAME=Thermobaculum terrenum ATCC BAA-798; strain=ATCC BAA-798; AL=Complete Genome; RT=Major
Sequence
MDSERLARAVDLMTRLRYDALLCRVPEHVFMLTGYLPVMGNSFCLVRLDPGGRLQVLLAV
PEDERDLVPPGAADDVRTFSEETGAQIQDTLQAVRECLQVLLISAALGPRCVIGYEGGQH
PITAPYTQVGFPGKATVDLLRQLRPEAELVDATPLLDRLAAFRTQAELGLMRQATTLAIL
GFDAARSAIVPDATEADVEAQSTAAIIAAGRRDYPDKHIAAHVHVMSGERSARAYRAYNT
TSDRMLQRGDPVLVQMEVCVGGCWAELTRTFFVGEISRQWEVVLGACMRAQREALYKIRP
GASGSKVDAEARKVMRDAGLGEAFRHGLGHGVGLQAINHGAQPRLHPASGDVLHPGMTHN
VEPAAYLDGQGGLRLNDNVLVIPTGCQLLSQGLPRAVDWLVAG
Download sequence
Identical sequences D1CH05
gi|269839156|ref|YP_003323848.1| WP_012876057.1.85100 525904.Tter_2124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]