SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012877518.1.53538 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012877518.1.53538
Domain Number 1 Region: 16-211
Classification Level Classification E-value
Superfamily Formyltransferase 8.5e-60
Family Formyltransferase 0.0000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012877518.1.53538
Sequence length 213
Comment phosphoribosylglycinamide formyltransferase [Xylanimonas cellulosilytica]; AA=GCF_000024965.1; RF=representative genome; TAX=446471; STAX=186189; NAME=Xylanimonas cellulosilytica DSM 15894; strain=DSM 15894; AL=Complete Genome; RT=Major
Sequence
MQTPSGHPVGSTSAARLVVLASGGGSNLAALLAAHDAPGYGARVVGLVTDKPTAGALDLA
RDAGIASAVVAPADFEDRAAWDRGVAEAVAVFRPDLVVLAGFMRILSPSFLDRFPGRVVN
THPALLPSFPGAHGVRDALAHGVRVTGCTVHVVDAGVDTGPILAQVAVPVLPDDDEASLH
ERIKVAERALLVETVGRIARDGLRVVDGRAVIG
Download sequence
Identical sequences D1BXG6
gi|269955545|ref|YP_003325334.1| WP_012877518.1.53538 446471.Xcel_0737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]