SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012896219.1.51822 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012896219.1.51822
Domain Number 1 Region: 9-279
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.14e-54
Family Methylenetetrahydrofolate reductase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012896219.1.51822
Sequence length 281
Comment 5,10-methylenetetrahydrofolate reductase [Thermotoga naphthophila]; AA=GCF_000025105.1; RF=na; TAX=590168; STAX=93930; NAME=Thermotoga naphthophila RKU-10; strain=RKU-10; AL=Complete Genome; RT=Major
Sequence
MRKSLETGKCVVLEVLTPRGTNLSKFMEFTEEAWKTGIDAFTVTDMPMGRVRMAPWAASH
LLVESGKDVLMHFTRNTRNMIRIQSDLLGCHALGVKNLLLLSGDNPSHGDYPETTSVNDI
DILDLIRLTKLMNEGTDLAGNKIYGKTDFFVGGALNPFSDEDVERAKQKIEAGVDFLVTQ
PLFNSEVAKKIKEELNTKILASIVFFENAKQMSYFSNVPGIEIPDEIVNSAEKGDDYLKE
KSFESVLRFVEETKDVLDGFYIVAIVKDLEKIRKVVEIAKS
Download sequence
Identical sequences D2C7Q5
gi|281412326|ref|YP_003346405.1| 590168.Tnap_0900 WP_012896219.1.51822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]