SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012907583.1.100188 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012907583.1.100188
Domain Number 1 Region: 112-252
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 3.4e-31
Family PA2201 C-terminal domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012907583.1.100188
Sequence length 255
Comment hypothetical protein [Citrobacter rodentium]; AA=GCF_000835925.1; RF=na; TAX=67825; STAX=67825; NAME=Citrobacter rodentium; strain=ATCC 51459; AL=Contig; RT=Major
Sequence
MSENLQVRDSRRDKAYFDKWIHFLQKAVYETRKDIDSIPIQHRILSRLSRIHSYILTKCI
MKYGRGDPVSSFTDELKELVQIRKLFNEKFTCLTELGEQTKKMYSKLTLYIYYDFFCWLV
FLYCSGGKKSDFLEVLDLFGHKGEDALLDHVAVLLGDTNRSIASNNTLVYGKIYKPLLDV
ILASENDRPALMKKFVEGWYRSMKPAAWHGNDKSYEGVYYGYWCFEAALVVNLLNIDDSS
FKDNVYYPKDMIIKR
Download sequence
Identical sequences D2TQW0
WP_012907583.1.100188 WP_012907583.1.15646 WP_012907583.1.97068 gi|283787126|ref|YP_003366991.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]