SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012911217.1.69553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012911217.1.69553
Domain Number 1 Region: 38-195
Classification Level Classification E-value
Superfamily NTF2-like 2.34e-28
Family BaiE/LinA-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012911217.1.69553
Sequence length 311
Comment hypothetical protein [Pirellula staleyi]; AA=GCF_000025185.1; RF=representative genome; TAX=530564; STAX=125; NAME=Pirellula staleyi DSM 6068; strain=DSM 6068; AL=Complete Genome; RT=Major
Sequence
MRTLAWFLAAAWLAATASTVSAQTRPPVPVPRPASATISPDEQQIREGVVKFVELYNAKK
AKELAALFAPEARVVYRDGTEVNGRDEIAKSFEAGFAASPKAAISVVVDSIRFLTADVAV
EEGDSINFPDGETQTSRSRYTVLHVKRDGVWQMQAIRTVEEESLSAYGDLQPLEWLIGDW
IDEGRSENVESTFRWDVNKSFLIEEFKVVREGAVVLQGTQRIGWDPQAKQVRSWVFDSAG
GFGEASWVMVGDAWVVKAKGVMADGTSNSATRVLIPEGASRVVWSSKDRLLGSEALPDIT
VTMVRKAPAAK
Download sequence
Identical sequences D2R3K1
gi|283780060|ref|YP_003370815.1| WP_012911217.1.69553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]