SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012911546.1.69553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012911546.1.69553
Domain Number 1 Region: 85-178
Classification Level Classification E-value
Superfamily Ribosomal protein L6 3.93e-31
Family Ribosomal protein L6 0.0000507
Further Details:      
 
Domain Number 2 Region: 1-84
Classification Level Classification E-value
Superfamily Ribosomal protein L6 7.07e-21
Family Ribosomal protein L6 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012911546.1.69553
Sequence length 181
Comment 50S ribosomal protein L6 [Pirellula staleyi]; AA=GCF_000025185.1; RF=representative genome; TAX=530564; STAX=125; NAME=Pirellula staleyi DSM 6068; strain=DSM 6068; AL=Complete Genome; RT=Major
Sequence
MSRIGNKPVPVLDGVKVSLSGRKVLVEGPKGKLEWEPSKPISVEVDAATKEIVVKRVDDE
RESRALHGLSRAIINNMIIGVKNGYEKRLEVVGVGYVVSLKGTILNLRVGLANELKREIP
AGLTVTCPDQTHIVIQGCDKQKVGQFAAELRSLRKPEPYKGKGVRYQGETIKLKPGKAAT
K
Download sequence
Identical sequences D2R5V2
WP_012911546.1.69553 gi|283780389|ref|YP_003371144.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]