SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012931567.1.44340 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012931567.1.44340
Domain Number 1 Region: 1-263
Classification Level Classification E-value
Superfamily Phase 1 flagellin 5.23e-93
Family Phase 1 flagellin 0.000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012931567.1.44340
Sequence length 263
Comment flagellin [Conexibacter woesei]; AA=GCF_000025265.1; RF=representative genome; TAX=469383; STAX=191495; NAME=Conexibacter woesei DSM 14684; strain=DSM 14684; AL=Complete Genome; RT=Major
Sequence
MSLRINTNVEAFNAHRNLEGTSSKLAKSMERLSSGFRINRAADDAAGLAISEKLRGQIGG
LNQARRNVQDGISLVQTAEGSLTEVHSMLQRVRELAVQHATGTLAREDRGAIASEIAQLT
QEVERIGTTSQFNGITLLDGRNATVAFQVGANDGETISVATVSLQARVGRLDQTSTLAQI
DTAIANVSDARAVFGAVQNRLEHTYNNLSVYQENLTASESRIRDVDMAAEMVNFTKNNIL
QQAGTSMLAQAQQAPQSVLSLLR
Download sequence
Identical sequences D3F431
WP_012931567.1.44340 gi|284041549|ref|YP_003391889.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]