SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012942632.1.92728 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012942632.1.92728
Domain Number 1 Region: 2-20,71-167
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 0.0000000563
Family Diacylglycerol kinase-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012942632.1.92728
Sequence length 339
Comment ATP-NAD kinase [Haloterrigena turkmenica]; AA=GCF_000025325.1; RF=representative genome; TAX=543526; STAX=62320; NAME=Haloterrigena turkmenica DSM 5511; strain=DSM 5511; AL=Complete Genome; RT=Major
Sequence
MTRVGLIANPAAGRDIRRLTGGASVVDNYAKRRVAECVLEGLAVVAEPPDVAVMPDRSGI
ADHAVSEAPDDLAVERVEMTVEESAADTRRAAARFRESADAVVVLGGDGTTRDVALEIGD
VPLVSVSTGTNNVVPTPVDGTVAGAAAAAVATGAADADAVTDRHGRIDVRADDVNGEKRL
TGLAAVEITDRSFVGTRAVIDPSELIGGVVSRAHPSDIGLGSVAGCLEPLAPDAPGGVAL
RLDDPEVTARSVSAIVAPGMTATIGVAERDRLEWDEPATFDVSDVVVGADGERELEVVDA
TVEMTPTADGPRLVDADAALGAAVEAGALVRDGPLLEER
Download sequence
Identical sequences D2RQ68
gi|284164721|ref|YP_003403000.1| WP_012942632.1.92728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]