SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012944748.1.92728 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012944748.1.92728
Domain Number 1 Region: 512-595
Classification Level Classification E-value
Superfamily RuvA domain 2-like 1.08e-20
Family Hef domain-like 0.028
Further Details:      
 
Domain Number 2 Region: 17-96
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 7.98e-18
Family GIY-YIG endonuclease 0.01
Further Details:      
 
Domain Number 3 Region: 199-246
Classification Level Classification E-value
Superfamily C-terminal UvrC-binding domain of UvrB 0.00000000432
Family C-terminal UvrC-binding domain of UvrB 0.0095
Further Details:      
 
Weak hits

Sequence:  WP_012944748.1.92728
Domain Number - Region: 89-158
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.0309
Family 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012944748.1.92728
Sequence length 597
Comment excinuclease ABC subunit C [Haloterrigena turkmenica]; AA=GCF_000025325.1; RF=representative genome; TAX=543526; STAX=62320; NAME=Haloterrigena turkmenica DSM 5511; strain=DSM 5511; AL=Complete Genome; RT=Major
Sequence
MNADGVRERAKSLPREPGVYQFRAEGTTLYVGKAVDLRSRVRSYADPRTARIRRMVDRAD
EIEIAVTDTETQALLLEANLIKRHQPRYNVRLKDDKSYPMVQLTDHEAPRIEITRDPDGE
AQGASSASGGAASGPTVFGPFTNKGQVETVVKALRETYGVRGCSDHKYSGRDRPCLDYEM
GLCTAPCTREIDLESYAQDVTAVERFFEGETGILADPLRREMEAAAEDQNFERAANLRDR
LETVETFHGEGGEAVQSVGDERAVDVLGVAIEGEDATVARLRAERGKLVDRDRHTLEAPA
AEGAGTEEGGVPAVLAAFIVQYYAERDLPDALLLPERHGDDEVAAWLEAEGVSVRVPGAG
REAKLVDLALKNARRNVGGRDECGMLADALEIDAARRVEGFDVSHAQGKSAVGSDVTFVD
GSAEKADYRRKKLTDQNDDYDNMRALLEWRASRAVEGRDDRPDPDLLLIDGGEGQLEAAR
DALAAVGWDVPAVALAKAEERVVTPDRTFSWPSDAPHLHLLQRVRDEAHRFAVQYHQTVR
DEVKTVLDDVPGVGPETRKRLLGRFGSVENVREASVDDIESVEGIGEKTAETIKSRL
Download sequence
Identical sequences D2RRA5
WP_012944748.1.92728 gi|284166895|ref|YP_003405174.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]