SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012947192.1.76031 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012947192.1.76031
Domain Number 1 Region: 1-298
Classification Level Classification E-value
Superfamily Phase 1 flagellin 8.89e-56
Family Phase 1 flagellin 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012947192.1.76031
Sequence length 298
Comment flagellar hook-associated protein 3 [Geodermatophilus obscurus]; AA=GCF_000025345.1; RF=representative genome; TAX=526225; STAX=1861; NAME=Geodermatophilus obscurus DSM 43160; strain=DSM 43160; AL=Complete Genome; RT=Major
Sequence
MRITHRAVTQTALLGLNTNLSSVAKLQQQLTSGKLISAPSDSPTGTNKALQIRQDQSAVE
QFAKNISDGQSWLDATDTALNEAVAQVQRVRALTVQAMNDGAVSTSSQRAIAVEVAALRE
SLLGVANSSINDRALFGGVTQGSTAYSADGTYVGAPPVGEGITRRVSNADRIRIDVTGHE
AFGVPSPGNPDLFGLVGKIAADVGTAPDALSADLEQLDAALDRLLGAAASVGARSTRMEA
AGQVNTDLQLTLASQLVAVEDIDLAKTIMELSQTEVGYKAALQATAQVIQPTLVDFLR
Download sequence
Identical sequences D2S9N8
WP_012947192.1.76031 gi|284989568|ref|YP_003408122.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]