SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012954444.1.87152 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012954444.1.87152
Domain Number 1 Region: 2-214
Classification Level Classification E-value
Superfamily PLP-binding barrel 7.36e-65
Family "Hypothetical" protein ybl036c 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012954444.1.87152
Sequence length 218
Comment YggS family pyridoxal phosphate enzyme [Candidatus Atelocyanobacterium thalassa]; AA=GCF_000025125.1; RF=na; TAX=1453429; STAX=713887; NAME=Candidatus Atelocyanobacterium thalassa isolate ALOHA; strain=ALOHA; AL=Complete Genome; RT=Major
Sequence
MEINKRITQIRSEIPSSVSLIVVSKQQSVESIKEAYNSGIRDFAENRLQEALEKQEELKE
YDDISWHFIGHLQTNKAKKVLENFNWIHSVDSLRLAQHLNQIIEKISASPYICLQVKAMP
DPDKYGWLPETLWEDLHELEKCKNLMIRGLMTILPLNLSTNESLHAFQKVQTLAQDINEK
SSLFLKELSMGMSNDYLLAIQKNTTMIRLGRTIFEPKR
Download sequence
Identical sequences D3EQK7
gi|284929616|ref|YP_003422138.1| WP_012954444.1.87152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]