SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012973543.1.27297 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012973543.1.27297
Domain Number 1 Region: 9-288
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 4.32e-100
Family Methylenetetrahydrofolate reductase 0.0000000311
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012973543.1.27297
Sequence length 301
Comment methylenetetrahydrofolate reductase [NAD(P)H] [Azospirillum lipoferum]; AA=GCF_000010725.1; RF=na; TAX=137722; STAX=193; NAME=Azospirillum sp. B510; strain=B510; AL=Complete Genome; RT=Major
Sequence
MTAPISAPPSISFEFFPPKTEKMEQSLWQSIRRLAPLSPGFVSVTYGAGGSTRERTHATV
CRIQAETGIPAAAHFTCVGATRDEIDAIARTYWDAGIRHLVALRGDPPETAGGVGGKYEP
FPGGYAYAADLVAGMKRIADFEISVAAYPEAHPEAPSAQFDLDNLKRKIDAGATRAITQF
FFDNDVYYRFLDRCAAAGIHVPIVPGILPITNFARAVEFADRCGASMPAKLAETFEGLDD
DPETRQLVAATVAAEQCQELQARGVNDFHFYTLNRSDLTIAICRMLGVKAKAAPAAAPVA
G
Download sequence
Identical sequences D3NT28
gi|288957760|ref|YP_003448101.1| WP_012973543.1.27297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]