SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012996800.1.81346 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012996800.1.81346
Domain Number 1 Region: 1-169
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.67e-32
Family GHMP Kinase, N-terminal domain 0.00034
Further Details:      
 
Domain Number 2 Region: 176-327
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 3.02e-31
Family Mevalonate 5-diphosphate decarboxylase 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012996800.1.81346
Sequence length 327
Comment diphosphomevalonate decarboxylase [Natrialba magadii]; AA=GCF_000025625.1; RF=representative genome; TAX=547559; STAX=13769; NAME=Natrialba magadii ATCC 43099; strain=ATCC 43099; AL=Complete Genome; RT=Major
Sequence
MKATAMAHPIQGLVKYHGMRDDIERLPYHDSISVCTAPSHTRTTVEFSMDYDEDTYVVDG
EELEGRAAERVDAVVEKARDMSDAAHTVYPVRLESENSFPTNVGLGSSSSGFAAAAMALA
EAADLDADRPTVSTIARVGSASAARAVTGAFSQLNTGLNDEDCRSERLPSNLHEDLKIVV
GLVPYHKETEDAHNEAEDSHMFQARNAHIHSQIAEMRDALRNDEFEDAFELAEHDSLSLA
ATTMTGPEGWVYWQPATLAIFNRVRELREEEDIPVYFSTDTGASVYVNTTEEHAEFVEEE
IADCGVSTTIWDVGGPARLLDEDEHLF
Download sequence
Identical sequences D3SS11
gi|289582881|ref|YP_003481347.1| WP_012996800.1.6702 WP_012996800.1.81346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]