SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013013745.1.78507 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013013745.1.78507
Domain Number 1 Region: 1-120
Classification Level Classification E-value
Superfamily AF1862-like 5.62e-30
Family Cas Cmr5-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013013745.1.78507
Sequence length 130
Comment type III-B CRISPR module-associated protein Cmr5 [Meiothermus ruber]; AA=GCF_000024425.1; RF=representative genome; TAX=504728; STAX=277; NAME=Meiothermus ruber DSM 1279; AL=Complete Genome; RT=Major
Sequence
MPQTRNQKDMKRALELVSSLEQADPELKRIYGGLCHSFPVMVLQSGLCQAVAFSADKASG
EGPRARAHQKLLEHLGAILEVEGDLLAHLHQAPTTVYMHHTRRVLEAWVYFKRFAKSVLK
VETGGDDEGR
Download sequence
Identical sequences A0A0S7APX2
gi|291295865|ref|YP_003507263.1| WP_013013745.1.12476 WP_013013745.1.70660 WP_013013745.1.78507 WP_013013745.1.82968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]