SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013019067.1.89426 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013019067.1.89426
Domain Number 1 Region: 116-354,391-532
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.55e-39
Family AAT-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013019067.1.89426
Sequence length 548
Comment aspartate 4-decarboxylase [Stackebrandtia nassauensis]; AA=GCF_000024545.1; RF=representative genome; TAX=446470; STAX=283811; NAME=Stackebrandtia nassauensis DSM 44728; strain=DSM 44728; AL=Complete Genome; RT=Major
Sequence
MTMMESGHHTARTEQKRLEGLSPFELKDSLISLADDHQKNTAMQMINAGRGNPNWIAVKP
REAFFLLGNFGIAESRRDWSEFEVLGGMPQKDGIAERFRAFLNSNADAPGADLLRDSLDY
GVNRLGFDADAFVHELADAVIGDQYPVPDRMLTHFEKVVHAYLVQEMCAGQAPAADYDLF
AVEGGTAAMCYIFDSCMTNKLLHKGDKIAIMSPIFTPYLEIPHLERYQFDVVELNATRVD
DQGFHTWQYPDSEIDKLADPGIRALFCVNPSNPPSVMLARESMDRIASIVNEKNPELTVI
TDDVYGTFVDGFRSLMSVIPKNTIGVYSFSKYFGCTGWRLGVIAVNQVNVFDERLATLPK
ADKQTLNERYGTLTLEPEKLRFIDRIVADSRQVALNHTAGLSLPQQTQMALFSLMALLDG
DDTYKSTCKAVIARRLEALTRGLGVDLPADPLAAHYYMELDLLSWAERHWGPEFATWMRE
NYEPVDPIFRLAEEDSVVLLNGGGFDGPEWSVRVSLANLPMAAYERIGKALWNIGQEYKR
AFDARKGG
Download sequence
Identical sequences D3PYR3
gi|291301311|ref|YP_003512589.1| WP_013019067.1.89426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]