SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013019716.1.89426 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013019716.1.89426
Domain Number 1 Region: 5-253
Classification Level Classification E-value
Superfamily Cgl1923-like 6.67e-78
Family Cgl1923-like 0.0000865
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013019716.1.89426
Sequence length 282
Comment PAC2 family protein [Stackebrandtia nassauensis]; AA=GCF_000024545.1; RF=representative genome; TAX=446470; STAX=283811; NAME=Stackebrandtia nassauensis DSM 44728; strain=DSM 44728; AL=Complete Genome; RT=Major
Sequence
MTPTDGLPDLRSPVLVAAFTGWNDAADAASHVIAHLSEQWQAEHTATIDPDPYYDFQMAR
PSVKVTAEGVERVDWPYTGFSVASPTDADRDVVLLTGAEPSMHWRGFCAEVAEICHSLGV
EQVILLGSLMADVGYTRPLPVSGTTNDPALAKRMKMDPVDYEGPAGIIAVLQATFQEAGV
PVTSCWVHVPHYAATSPCPKATLGLLHRVEELLDLPVPAGGLVEQTAQWENDVTQLVEAD
SDIADYISSLDEPQAGDEPSGDDIAKDFERYLRRRGPHTDDN
Download sequence
Identical sequences D3Q596
gi|291301960|ref|YP_003513238.1| WP_013019716.1.89426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]