SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013027381.1.45518 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013027381.1.45518
Domain Number 1 Region: 344-428
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.28e-23
Family CorC/HlyC domain-like 0.0000463
Further Details:      
 
Domain Number 2 Region: 200-335
Classification Level Classification E-value
Superfamily CBS-domain pair 1.22e-19
Family CBS-domain pair 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013027381.1.45518
Sequence length 439
Comment membrane protein [Pantoea ananatis]; AA=GCF_001475725.1; RF=na; TAX=553; STAX=553; NAME=Pantoea ananatis; strain=NS311; AL=Contig; RT=Major
Sequence
MLDSLLVILLLIVISAFFSLSEISLAAARKIKLKLLADEGNINAQRVLKMQETPGMFFTV
VQIGLNAVAILGGIVGDAAFSPAFSSLFNRFMSHELAEQLSFICSFTIVTSLFILFADLT
PKRVGMIAPETIALRIINPMRFCLLVMRPLVWLFNGLANVFFRIFKLPMVRKDDITSDDI
YAVVEAGALAGVLRKQEHELIENVFELESRTVPSSMTSRENIVWFDLHEDEVSLKTKIAQ
HPHSKFLVCNGDIDHIVGYVDSKELLLRVLGNQSMALNSGVQIRSALIVPDTLTLSEALE
SFKTAGDDFAVIMNEYALVVGIITLNDVMTTLMGDLVGQGMEEQIVARDENSWLVEGGTP
IDDVMRVLDIDDFPQSGNYETIGGFMMYMLRKIPKRTDFVKFAGYKFEVVDIDSYRIDQL
LVTRIDERPPMLNVAKTEE
Download sequence
Identical sequences A0A0H3L0H0 A0A221NCA4 D4GNX5
gi|386077753|ref|YP_005991278.1| gi|291619066|ref|YP_003521808.1| WP_013027381.1.100875 WP_013027381.1.101504 WP_013027381.1.22816 WP_013027381.1.25584 WP_013027381.1.31804 WP_013027381.1.32245 WP_013027381.1.32872 WP_013027381.1.34141 WP_013027381.1.34937 WP_013027381.1.36791 WP_013027381.1.37529 WP_013027381.1.41207 WP_013027381.1.44942 WP_013027381.1.45518 WP_013027381.1.46475 WP_013027381.1.47668 WP_013027381.1.57057 WP_013027381.1.57813 WP_013027381.1.61179 WP_013027381.1.7182 WP_013027381.1.72032 WP_013027381.1.89124 WP_013027381.1.95616 WP_013027381.1.98075 gi|386017319|ref|YP_005935617.1| gi|378765506|ref|YP_005193966.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]