SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013028693.1.26305 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013028693.1.26305
Domain Number 1 Region: 4-188
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.23e-68
Family Methylesterase CheB, C-terminal domain 0.000000897
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013028693.1.26305
Sequence length 189
Comment chemotaxis protein CheB [Sideroxydans lithotrophicus]; AA=GCF_000025705.1; RF=representative genome; TAX=580332; STAX=63745; NAME=Sideroxydans lithotrophicus ES-1; strain=ES-1; AL=Complete Genome; RT=Major
Sequence
MGGKIVVVGSSTGGTEALKVFLSAMPEHAPAILIAQHMPELFTRSFAERLDHLCAVHVKE
AGHHEDIVAGHVYLAPGHSHLSLECVAGKYRTVLSRDPPVNRHRPSVEVLFHSAARCLGA
NAIGVMLTGMGKDGAAAMLEMKRAGAYNFAQDEASCVVFGMPREAIALGAVDEVLPLDRI
AERVLARVR
Download sequence
Identical sequences D5CMV8
gi|291613024|ref|YP_003523181.1| WP_013028693.1.26305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]