SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013036526.1.50250 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013036526.1.50250
Domain Number 1 Region: 65-252
Classification Level Classification E-value
Superfamily MetI-like 4.32e-22
Family MetI-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013036526.1.50250
Sequence length 277
Comment nickel ABC transporter permease [Methanohalophilus mahii]; AA=GCF_000025865.1; RF=representative genome; TAX=547558; STAX=2176; NAME=Methanohalophilus mahii DSM 5219; strain=DSM 5219; AL=Complete Genome; RT=Major
Sequence
MIKGIFNRSMLIGLILIGAVVFLALAAPWLAPQDPQKTNFDQRLLSPSSEYPFGTDHLGR
CILSRVLFAARISLFIGASVIAISFIAGTLIGSVSAYAGGIVDETVMRFVDGFLAFPSMF
IALAIAGIFGGNMTGLIIALSIVEWTAYARVSRGSVLTVKNVDYIAVSRMMGGRAPYILR
HHILPNITSPLLVISTLGMGNVILAAAGLSFLGLGVSSAPEWGMMVNEGRLFLQSAPHVM
FFPGIFIVITVLGFNFLGDGLRDIFDPRDTKQRWRLF
Download sequence
Identical sequences D5E8S4
WP_013036526.1.50250 gi|294494735|ref|YP_003541228.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]