SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013036726.1.50250 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013036726.1.50250
Domain Number 1 Region: 183-453
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.3e-71
Family Extended AAA-ATPase domain 0.000000198
Further Details:      
 
Domain Number 2 Region: 459-725
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.36e-71
Family Extended AAA-ATPase domain 0.000000927
Further Details:      
 
Domain Number 3 Region: 3-88
Classification Level Classification E-value
Superfamily ADC-like 3.6e-25
Family Cdc48 N-terminal domain-like 0.0022
Further Details:      
 
Domain Number 4 Region: 91-190
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 3.24e-18
Family Cdc48 domain 2-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013036726.1.50250
Sequence length 743
Comment ATPase [Methanohalophilus mahii]; AA=GCF_000025865.1; RF=representative genome; TAX=547558; STAX=2176; NAME=Methanohalophilus mahii DSM 5219; strain=DSM 5219; AL=Complete Genome; RT=Major
Sequence
MEELQIKVEKAHPIDFGRGIIRLDPSTLLSLQLSPGDIVLIEGKRQTTAKVWRADRQDWG
QGIARIDGYTRQNAEVGIGERITLSKAEPIPAEKILLAPPEGIVMEFGDNTSAVIKHNIL
KRPFVKGDIIPIISSMGQTTPGSQAIPLIAVDTEPSDGILIINENTQIQLQQKPVVGYEG
AARGINYEDIGGLRTEIQRVREMIELPLKHHELFLRLNIDPPKGVILYGPPGTGKTLIAR
AVASESNAYFINIAGPEIMGKYYGESEERLRKIFDEAAENAPSIIFVDEIDSIAPKREDV
TGEVERRVVAQLLTLMDGMDERKQVVVIAATNRLDSIDPALRRPGRFDREIEIGVPDSED
RLEILQIHTRGMPLNENIDEEYFEHLAEYTQGFVGADLLALVQEASMRALRRLLPDINLD
EEEIPQEILEKLEVTPDDFEEALKEIEPSAMREVMVEIPSVGWDDIGGLDLARQDISEAV
EWPLKWPDKISQMGIKPPTGILLYGPPGTGKTLLAQAVANEANANFISVKGPQILSKYVG
ESEKAIRDTFKKARQVAPCIIFFDEIDAISSTRQGGSDVGSRVSEQVVNQMLTEMDGLEP
LNEVVVIAATNRPDLIDPALLRSGRFDRLVMVGAALAEGREKIFRIHTMGIPLDSDVDIR
ELATMTEGYVGSDIESICREAAMLSLREDFDNEKVSKRHFLSAMEKVKPTVNEDMIDFYN
RVQEKLKGGSIRKTDAGSFAGYI
Download sequence
Identical sequences D5E9D2
gi|294494935|ref|YP_003541428.1| WP_013036726.1.50250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]