SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013037317.1.50250 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013037317.1.50250
Domain Number 1 Region: 46-502
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 1.27e-174
Family Type II DNA topoisomerase 0.000000000131
Further Details:      
 
Domain Number 2 Region: 514-822
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 5.62e-110
Family GyrA/ParC C-terminal domain-like 0.00000804
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013037317.1.50250
Sequence length 824
Comment DNA gyrase subunit A [Methanohalophilus mahii]; AA=GCF_000025865.1; RF=representative genome; TAX=547558; STAX=2176; NAME=Methanohalophilus mahii DSM 5219; strain=DSM 5219; AL=Complete Genome; RT=Major
Sequence
MADYDDINPLDEKIEQHDGEGGRVVPVLIQDEMKRSYIDYSMSVIVGRALPDARDGLKPV
HRRILHSMNEAGITHDKAYKKSARVVGDVLGKFHPHGDTAVYDSLVRMVQDFSLRYPLID
GQGNFGSVDGDSAAAMRYTEVRMDKITTEMLEDIKKGTVDFKPNYDGSLEEPEVLPSKLP
NLLLNGSTGIAVGMATNMAPHNLGEVVDATVKLIDDPETELAELRKIVKGPDFPTGGIIM
GTSGIKSAYETGRSPIYLRAVTEIEEMKNDKYRIVVYELPYQVNKARLVESIANLVRDKK
IEGISDLRDESGREGMRVVIELKKAANPKVLLNQLYKQTQLETTFGIINLALVDGVPRVL
NLRELIQIYLKHRIDVISRRTVFDLRKAEERAHILQGLKVALDNIDEVIKLIRGSSTTEE
AREGLISNFDLDEIQAKAILDMKLQRLTGLERQKIDEEYNGLIDTIADLKDILANDERKY
AIIRDEVLELKDKYGDERRTLIQSSREELADEDLIPEEEVVVTSTQSGYIKNIPLQTYNM
QHRGGRGVRGMETKEDDTVGSIFVASTHDYILFFTNRGKVYWQKVYDIPRGSRQSRGKAI
VNLLELAEGESVNAMIPVHDFENDRYLFMGTRDGTVKRCSLSDFSNPRKAGIIAISLKEG
DELVNVLQTDGNQDIMLASRHGKALRISEEDVRVMGRTARGVRGMKLAGPDVIVSLDVVD
SDGTLLTVTENGFGKRTPFDEYRTLRRGGQGVITIFTDMRNGPVVTVKTVEDDDEIILTS
SAGIVMRIPVTDIRVQGRNTKGVKIMNIREKDKLVSLARIKKEE
Download sequence
Identical sequences D5EB23
WP_013037317.1.50250 gi|294495526|ref|YP_003542019.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]