SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013037320.1.51233 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013037320.1.51233
Domain Number 1 Region: 22-272
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.21e-62
Family PdxS-like 0.0000000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013037320.1.51233
Sequence length 298
Comment MULTISPECIES: pyridoxal 5'-phosphate synthase lyase subunit PdxS [Methanohalophilus]; AA=GCF_001889405.1; RF=representative genome; TAX=2177; STAX=2177; NAME=Methanohalophilus halophilus; strain=Z-7982; AL=Complete Genome; RT=Major
Sequence
MELENLRHGTELIKRGFARMQKGGVIMDVTNPEQARIAEEAGAVAVMALQAVPADIRKAG
GVARMADPEIVAQIIDTVTIPVMAKARIGHFVEAEILESLGADMVDESEVLTPADEMYHI
DKTGFTVPFVCGARNLGEALRRINEGAAMIRTKGEAGTGDVREAVRHMKKIMGEVRELAG
KDKEELIKVARDIEAPIELVLESADLQRLPVVNFAAGGVATPADAALMMRLGADGVFVGS
GIFKAENPEMMAKAVVEAVNNYDNPEKLAEISRGIGSGMKGMSADTIPPEEALQTRGW
Download sequence
Identical sequences A0A1L3Q4G4 D5EB26
gi|294495529|ref|YP_003542022.1| WP_013037320.1.50250 WP_013037320.1.51233 WP_013037320.1.52505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]