SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013038365.1.50250 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013038365.1.50250
Domain Number 1 Region: 1-192
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.85e-55
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0000134
Further Details:      
 
Domain Number 2 Region: 305-423
Classification Level Classification E-value
Superfamily UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 5.36e-35
Family UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 0.0031
Further Details:      
 
Domain Number 3 Region: 203-297
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 1.16e-32
Family UDP-glucose/GDP-mannose dehydrogenase dimerisation domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013038365.1.50250
Sequence length 430
Comment UDP-glucose 6-dehydrogenase [Methanohalophilus mahii]; AA=GCF_000025865.1; RF=representative genome; TAX=547558; STAX=2176; NAME=Methanohalophilus mahii DSM 5219; strain=DSM 5219; AL=Complete Genome; RT=Major
Sequence
MRVSIVGSGYVGSVTAACFAELGHEVICIDIDEEKVRQINDGYPPVWEEGLEELMNKHVG
KNLIATSDYDYAVQNTDVSFICVGTPSSDNGEIDLSIVAAASKSLGESIASKNAYHTVVV
KSTVVPGTTEGVVRSILEEYSARKAGETLGLAMNPEFLREGRAVHDFLNPDKIVVGSLDR
RSDSIVSGLYRDIDCEVTSVNLRTAEMIKYVNNAFLATKISFANEVGNICKRLGIDTYQV
MDAVGRDFRINPAFLNSGAGFGGSCFPKDVRALIGSAKDLDYYPSLLESVIEVNELQPLQ
MVEILEDKLPEIKDKRIAVLGLAFKNDTDDIRESRSIPVIRKLLEKGADIHAYDPLAADN
MKKVFPDITYASSAQEALEGAQACLLMTEWDEFRKLNTEFDSMDRKLLVDGRYLLDPEEL
EDVEYEGLCW
Download sequence
Identical sequences D5E8D5
gi|294496575|ref|YP_003543068.1| WP_013038365.1.50250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]