SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013047454.1.58668 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013047454.1.58668
Domain Number 1 Region: 69-259
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.24e-57
Family Biotin holoenzyme synthetase 0.00011
Further Details:      
 
Domain Number 2 Region: 5-57
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000355
Family Biotin repressor-like 0.021
Further Details:      
 
Domain Number 3 Region: 278-319
Classification Level Classification E-value
Superfamily C-terminal domain of transcriptional repressors 0.0000119
Family Biotin repressor (BirA) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013047454.1.58668
Sequence length 323
Comment bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor [Aminobacterium colombiense]; AA=GCF_000025885.1; RF=representative genome; TAX=572547; STAX=81468; NAME=Aminobacterium colombiense DSM 12261; strain=DSM 12261; AL=Complete Genome; RT=Major
Sequence
MKKHIINILKQTQGTYVSGQDLCEQLGVSRTAVWKHINQLREEGYTIDSSARKGYRLIDV
PDLLNEYEVEPLLTTEVLGHPIIHFREVPSTNIEARKYAREGTAEGTVIVAEHQTAGRGR
SGRSWFSSPEWAIQMSLILRPKVSPALAASITQIGAAAVAKALESLGLSPQIKWPNDVLL
SEKKVCGILTEMSCELDHINHIVIGIGINVNTPHFPDDVASVATSVRIEKGETWNRKKLM
AAVLNSFEPLYKEFLEGKEHPEYLRICRALSNLIGQHITYETTKGRLSAKAIDIDNIGRL
IVQHSDGSTETLLSGEVHIGTQE
Download sequence
Identical sequences D5ECA6
WP_013047454.1.58668 gi|294101054|ref|YP_003552912.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]