SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013047858.1.58668 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013047858.1.58668
Domain Number 1 Region: 224-386,413-523
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.16e-23
Family Tandem AAA-ATPase domain 0.034
Further Details:      
 
Domain Number 2 Region: 423-506,565-603,633-713
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000101
Family Tandem AAA-ATPase domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013047858.1.58668
Sequence length 1064
Comment DEAD/DEAH box helicase [Aminobacterium colombiense]; AA=GCF_000025885.1; RF=representative genome; TAX=572547; STAX=81468; NAME=Aminobacterium colombiense DSM 12261; strain=DSM 12261; AL=Complete Genome; RT=Major
Sequence
MAFCECHLEEAALEWFEELGYEVVFAPDIAPEGTYPERTYYSDVVLTERLKEALARINPD
LPDDALEDGFRQIMFPQSPSLIMNNKTFQKMITDGIDVQVKQEDGGYRTEKAYIFDLEAP
SNNDFLVANQFTVVEHDKEKRPDIVVFVNGIPLVVIELKNASDENVDITDAFNQLQTYKK
TIPSLFTYNSFTVISDGVNARAGTLTSNEDRFMAWRTIDGDDVAPLCIPQLEVLIKGMFL
KDRFLDIIRHFVLFQSDGKEIKKILAGYHQYHAVNKALQSTQRATMEQGDRRVGVIWHTQ
GSGKSLSMVFYAGKLVIDEELENPTIVVITDRNDLDDQLFSTFLKSEELLRNTPVQAQDR
VHLRELLNNRTSGGIIFTTIQKFAPFTNETNGEVIDFNRWGRVAENSSPYTANTMLTDRR
NVVVIADEAHRSQYGFGAEIVMGKTEADVKYGYAKYMRDSLPNASYIGFTGTPVELTDKN
TRVVFGDYIDIYDMTRAVEDGTTVKIFYESRIAKLDLPEEMKPQIDSEYEEITEYQEYSQ
KERLKSKWARLEAIVGTEQRIKQIAKDIVEHFEKRDLAQENEGGKGMIVAMSRRIAIDLY
KEIVALRPDWHSDDLMSGKIKVVITGSSSDPSDWQAFIGSKADRETLAKRMKDRNDELKL
VIVRDMWLTGFDVPSMHSMYVDKPMSGHNLMQAIARVNRVFKEKQGGLVVDYIGIAENLK
NALAQYTESDKKTTGVDTEVASQVLLEKYDLIKELLHGHSYEKFFTGRQSEKMQAITETM
DFIIGLREDRKNDYINLVTEMARAYSLCATTDTAETLNVEVGFHKAVRACLHKIMSDGSK
KKTTSQLDNELNQLISKAISSNEVVDILSSVGLSKPNIAILSDEFLEEVKGMRQKNLAVE
LLNRLLKGSIKNFSRRNLVQSKRFSEMLEASIRKYQNRTIETTQVIMELIELAKEISGAE
KRGESTGLTSDELAFYDALADNESARDVMGDEILMQIAKDLTLSIRRNISVDWAIRENVQ
AKMKMDIKRLLKRYNYPPDKTPQAVDTVIAQAKLMCQKEVAYGS
Download sequence
Identical sequences D5EDG0
WP_013047858.1.58668 gi|294101458|ref|YP_003553316.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]