SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013047941.1.58668 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013047941.1.58668
Domain Number 1 Region: 129-307,436-595
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.85e-109
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000472
Further Details:      
 
Domain Number 2 Region: 13-117
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.29e-29
Family Anticodon-binding domain 0.00024
Further Details:      
 
Domain Number 3 Region: 305-430
Classification Level Classification E-value
Superfamily GAD domain-like 7.19e-29
Family GAD domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013047941.1.58668
Sequence length 602
Comment aspartate--tRNA ligase [Aminobacterium colombiense]; AA=GCF_000025885.1; RF=representative genome; TAX=572547; STAX=81468; NAME=Aminobacterium colombiense DSM 12261; strain=DSM 12261; AL=Complete Genome; RT=Major
Sequence
MSRSEHFDVSWKRTVRCGELSLDQEDNKVVLNGWVRRRRDLGGLIFIELWDYTGVTQVVI
NPELVPEVHERAKSLRSEFVISVHGKVRKRPEGTVNLSMKTGEIEVVAEDFMLLSPAAPL
PFEVSDATNKVDENLRLRYRYLDLRRDKMQRNLRIRNQIIRFTRDFLARYDFVDIETPML
TKSTPEGARDYLVPSRVNPGTFYALPQSPQIFKQILMVSGFDRYYQIVKCFRDEDLRADR
QPEFTQIDMEMSFITEEDIYALVEEFMAGLFREIAQVDIPTPFRKMDYWEAMDRFGSDKP
DLRIPFEIHDVAYIFKESDFAPFKDLLAKGGYVRGLPLPGGASLSRKEVSLVEEKAKKLG
ASGLACFQFKEGCLKGPLVKFLSEEQRQRLVEKAALHEGDAFFVLGDLNRSVASQILGQL
RLDLAKEHNLMDRDKWEFLWVVHFPLFERDEEENRWVAVHHPFTSPVIEDLPFLDSEPQK
VRSRAYDCVLNGNEIGGGSIRIHDPEIQEKVFQCLAFSREEARKRFGFLLDALSSGTPPH
GGIAFGVDRLVMLLCGASSIRDVMAFPKTQKAQCLMSGAPSFVSQEQLDELHIDSLAEED
QE
Download sequence
Identical sequences D5EDP3
WP_013047941.1.58668 gi|294101541|ref|YP_003553399.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]