SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013048031.1.58668 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013048031.1.58668
Domain Number 1 Region: 126-272
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.5e-59
Family C-terminal domain of ribosomal protein L2 0.00000342
Further Details:      
 
Domain Number 2 Region: 3-125
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.85e-49
Family Cold shock DNA-binding domain-like 0.00000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013048031.1.58668
Sequence length 275
Comment 50S ribosomal protein L2 [Aminobacterium colombiense]; AA=GCF_000025885.1; RF=representative genome; TAX=572547; STAX=81468; NAME=Aminobacterium colombiense DSM 12261; strain=DSM 12261; AL=Complete Genome; RT=Major
Sequence
MSIKEFKPYTPGRRAMSSQSFDEVTKSEPERALTTALKKAGGRNNLGRITMRHRGGGMKR
LYRIIDFKRDKIGVPGKVAAIEYDPNRSARIALIHYLDGEKRYILAPADLSVGDMVVAGP
ESDIKPGNALKLKDMPVGTVVHNIELEPGCGGKAVRSAGTSAQLMAKEGKYAYIRMPSGE
LRLVLNECMATVGQVGNVEHENISLGKAGKTRLLGRRPKVRGVVMNPVDHPLGGGEGRSK
SHKHPVSPWGTLAKGYRTRKNKPSDRLIVRRRYAK
Download sequence
Identical sequences D5EDY3
gi|294101631|ref|YP_003553489.1| WP_013048031.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]