SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013048111.1.58668 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013048111.1.58668
Domain Number 1 Region: 213-391
Classification Level Classification E-value
Superfamily PheT/TilS domain 3.4e-54
Family B3/B4 domain of PheRS, PheT 0.0000144
Further Details:      
 
Domain Number 2 Region: 471-698
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.59e-40
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00014
Further Details:      
 
Domain Number 3 Region: 41-192
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.03e-27
Family Myf domain 0.006
Further Details:      
 
Domain Number 4 Region: 705-796
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 4.84e-26
Family Anticodon-binding domain of PheRS 0.00032
Further Details:      
 
Domain Number 5 Region: 424-479
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000174
Family Domains B1 and B5 of PheRS-beta, PheT 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013048111.1.58668
Sequence length 801
Comment phenylalanine--tRNA ligase subunit beta [Aminobacterium colombiense]; AA=GCF_000025885.1; RF=representative genome; TAX=572547; STAX=81468; NAME=Aminobacterium colombiense DSM 12261; strain=DSM 12261; AL=Complete Genome; RT=Major
Sequence
MLVSWNWLNGLVSIPASLEEVAEKLTLTGCEVEAITRPCERLSGVRVAQVIALEPHSRKN
SLRVASLNYGEGAAVCVTAATNLKIGDLVPYGPSGAVLADGTVLGERDFDGVVSQGMMLS
ADEIGLPDIADESGILRLPSDAPVGKDVKKYLRLDDAVLDISITPNRGDLLSALGIAREV
YALFPDVVGRKNFKNRSNEGMEWPVNFRSISLEDEGCRCYLLGLATDVKIEPSPLPIRIL
LSLMGMRPISNIVDATNLTMLLMGQPLHAFDLDRLPENEITVRSATPEEKIITLDGKERV
LDPLDILITSGGSAIGIAGVMGGENTEICETTRNVVIESANFDAIRVSRTSRRLGLNSEA
AFRYSRGVDPELVYPAMAYVISLLKKWGAATTEWEVLEATTGSISGREVVLTREKLNKLL
LWDDLQESSQILGRLGIREVSKEKENMRIFKIPSYRPDISIEEDLIEEVARIRGYNDMPS
RLPQKMSHPGERGAWTELQAGLRQIALARGYIEVVTYSFLSPSYIKLLRLPEDDERAHPF
VLSNPLSADLSAMRTLMLPGLINALASSLRSGWREAVRLFELGRVFLRDSESDAGKKEVE
RLAGLIYPGRDIRNVYKECLVEDFMSVKSDVEAFLQSRGVNYILRLGAEPFGHGGQTAEI
CIGNEKVGYIARLKPSLEKELDMGSPIYAFEISLDPLIEDVHPLFCENPPYPAVHRDISL
LVPENKEGKTVEDEIRSAAGSLLWNLRLFDVYKGHGVPEGSRSLAFSLAYRDMKRTLSDE
EVDAVHNRVREEMASKGYTLR
Download sequence
Identical sequences D5EE63
WP_013048111.1.58668 gi|294101711|ref|YP_003553569.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]