SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013048161.1.58668 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_013048161.1.58668
Domain Number - Region: 190-270
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00392
Family Nucleotide and nucleoside kinases 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013048161.1.58668
Sequence length 271
Comment phosphoenolpyruvate synthase regulatory protein [Aminobacterium colombiense]; AA=GCF_000025885.1; RF=representative genome; TAX=572547; STAX=81468; NAME=Aminobacterium colombiense DSM 12261; strain=DSM 12261; AL=Complete Genome; RT=Major
Sequence
MHDMKKQVEVFVVSDFTGETAESVARAASSQFDPQSVKLRRFRYINNIDKAREMLEIASS
KHAIVICTFVDKIVRHWVIENSDSLNVDVIDVFGPLLNTLSDILDKEPLEKPGLSHVMDE
EYFKRVKAVEFTISCDDGSNTHLLPEADLIIIGVSRTCKTPLSMYLAHKGIKTANIPLIP
DLAPPEELFEVDSSRIIGLTIDPKALIDIRLKRLVMLGLDSEGSDYAQIAKVYEELAYAD
SIMKALGVRVFDVTDRALEETAQEILAYIRH
Download sequence
Identical sequences D5EEB3
WP_013048161.1.58668 gi|294101761|ref|YP_003553619.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]