SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013048410.1.58668 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013048410.1.58668
Domain Number 1 Region: 209-296
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.06e-26
Family Cold shock DNA-binding domain-like 0.00078
Further Details:      
 
Domain Number 2 Region: 279-367
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.12e-25
Family Cold shock DNA-binding domain-like 0.0011
Further Details:      
 
Domain Number 3 Region: 368-453
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.12e-21
Family Cold shock DNA-binding domain-like 0.00097
Further Details:      
 
Domain Number 4 Region: 15-126
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000821
Family Cold shock DNA-binding domain-like 0.011
Further Details:      
 
Domain Number 5 Region: 131-204
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000117
Family Cold shock DNA-binding domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013048410.1.58668
Sequence length 503
Comment 30S ribosomal protein S1 [Aminobacterium colombiense]; AA=GCF_000025885.1; RF=representative genome; TAX=572547; STAX=81468; NAME=Aminobacterium colombiense DSM 12261; strain=DSM 12261; AL=Complete Genome; RT=Major
Sequence
MMEEMNNDVKTTENFENMDMESMLEKYAGEEIHKGKVVTGTIVGANEDGWLVDVGYKCEG
FLPRREWTHKILVEEEEEPSINDEIQVQVINIRHGEDAQLLVSRWRCEFDRRWAELESFV
SSHDLISVRGIRKVKGGLMVNCFNLEGFIPISHLAEEGRGVNPGKFVGEVFDVKLLEKDR
RKRRLVLSRRMLVEEAVEEQRNKFYTTVSEGDILEGRVSSITSFGAFINLGPIDGLVHIS
ELSWKRNVKPKEVVKKGETVKVKVIGIEQENNRVSLSIKQTQPDPWSIVEENWKIGDKAS
GVVTNVTDFGAFVEVGPGIEGLIHIGDLSWARIKHPRDVLKKGQNVEVVVLDVDAEKKRM
SLGYKQLNDPWTGIEERYTKGQDITVKVVRLADFGAFVEVEEGVEGLIHISQLSTKRVDK
PEDVLSEGEEVLARVIEINPAERRMRLSISALFEEEIRKNREEEKKKRLAQKAEESRQKQ
QPTFHEEEPSITIGDVLKDFLNR
Download sequence
Identical sequences D5EF15
gi|294102013|ref|YP_003553871.1| WP_013048410.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]