SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013048632.1.58668 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013048632.1.58668
Domain Number 1 Region: 4-169
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.41e-42
Family G proteins 0.0038
Further Details:      
 
Weak hits

Sequence:  WP_013048632.1.58668
Domain Number - Region: 226-294
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 0.0693
Family Glutamyl tRNA-reductase dimerization domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013048632.1.58668
Sequence length 677
Comment ferrous iron transporter B [Aminobacterium colombiense]; AA=GCF_000025885.1; RF=representative genome; TAX=572547; STAX=81468; NAME=Aminobacterium colombiense DSM 12261; strain=DSM 12261; AL=Complete Genome; RT=Major
Sequence
MGNITLALAGNPNTGKTSLFNLLTGSRQHVGNWPGVTVERKEGHFSYEGMNFTLVDLPGI
YSLGAASIDEQVASEFLIKEKPELAITVVDASNLERSLYLVVQMLEAGQPLIIALNMADV
AENKGIRIHREKLEKALGVPVVPTVARERKGLEDLVKRVKDRFENGVSLSLLAIPYGEKV
EQSLDRIAKNVSSALLREANIDRRLASIKIAEGDPLIISMLEKLGEAKEVTAIVEEENER
LELELGYDLLTAVIERRWNFISAITQKVAERNLSLKKNLSPSDKIDRIVTHKIWGLPIFL
IITWFMFRFTYAVGDPIADYLDGTISALGERIAFLMETAGFPLFAGSFVADGVIGGVGSI
VVFFPHIMVLFAFIAILEDSGYMARGAFVMDRIMRAMGLHGKSFIPMLMGFGCNVPSIMA
TRVLERPRDRMITLLVLPFMSCSARLPVYLLFAGIFFGNHAGTIVFSLYVLGIAIAVISA
KVLGSTLFKGESSQFVMELPPYHLPQAGSVLKSAWERASLFLKKAGTVIFGAVIIVWVMA
SLPLGVEYGSHESIVGRIGDMLAPLFAPAGFGFWQAGVALFFGFFAKEIVVGTLGTLLAG
GEAGLASALPALFSPLSAYAFLVMTLLYVPCIAAVAAFKRETNSWKWTFFMIAYTTLIAY
GAAVIVYQGGQLLLGLS
Download sequence
Identical sequences D5EFN7
gi|294102235|ref|YP_003554093.1| WP_013048632.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]