SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013049861.1.44054 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013049861.1.44054
Domain Number 1 Region: 147-345
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.1e-55
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.000000296
Further Details:      
 
Domain Number 2 Region: 431-559
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 6.41e-32
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000558
Further Details:      
 
Domain Number 3 Region: 12-146
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.6e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.0016
Further Details:      
 
Domain Number 4 Region: 347-422
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 8.67e-21
Family Duplicated SiR/NiR-like domains 1 and 3 0.0000896
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013049861.1.44054
Sequence length 577
Comment sulfite reductase subunit beta [Shewanella violacea]; AA=GCF_000091325.1; RF=representative genome; TAX=637905; STAX=60217; NAME=Shewanella violacea DSS12; strain=DSS12; AL=Complete Genome; RT=Major
Sequence
MSENKNAEQAEPLSINEHLKTDSNFLRGTIQEGLDTAVTGSFSEGDQQLIKFHGFYQQDD
RDLRNERKEQKLEPLYSFMLRARVAGGVCTPDQWLGVDEIASTLTSSNSIRLTTRQTFQY
HGISKRNLRALIQSLDSKALDSIAACGDVNRNVMCNPNPVESRLHEQAFYWAKKLSDNYL
PRTKAYAEIWLGDDKLATSEGDDVEPVYGKTYLPRKFKMAVAVPPDNDVDVYTNDLGFIA
VAEEGELIGFNLVAGGGMGSTHGEVQTFPRLADDFGYIKAEDTLKFAEAILKVQRDWGNR
SNRKLSRLKYTIVKYGYEVFKAEVEKRAGVKFEPKRDVVIGDRGDRYGWIKGVDNQWHLT
LFIEGGRIKDLPGQPLQTGLREIAKIHKGDFRMTSNQNLIIARVAAEDKAEIEALARSHG
LMGKLITETRGRSIACVALPTCALAMAEAERYFPDFLTKVESLQEKHGFLNQGIVIRMTG
CPNGCARPFAAEIGLVGKAPGRYNLYLGASFEGTRLNKLYRENIQEAEILSELDTLFARY
VGEREEGETFGNFTVRIGVVAAVIDAAKDFHGQSSNA
Download sequence
Identical sequences D4ZFU9
gi|294139348|ref|YP_003555326.1| WP_013049861.1.44054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]