SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013054517.1.77063 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013054517.1.77063
Domain Number 1 Region: 2-145
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 4.06e-27
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013054517.1.77063
Sequence length 149
Comment PTS sugar transporter subunit IIA [Mycoplasma crocodyli]; AA=GCF_000025845.1; RF=representative genome; TAX=512564; STAX=50052; NAME=Mycoplasma crocodyli MP145; strain=MP145; AL=Complete Genome; RT=Major
Sequence
MSKLFKEEMMEYNTTIKDWKKAVNRGVEILAQNGYATMELEKAILDSTEKFGAYYVLEKG
IALIHAAPGNYILKNGTSTIILDENIVFNNQEEKQAKILVTLAATDSNSHLGILQEFSHY
FMNEDFKKEALNVKNLNEFKILLNKYKGE
Download sequence
Identical sequences D5E517
gi|294155476|ref|YP_003559860.1| WP_013054517.1.77063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]