SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013057340.1.65684 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_013057340.1.65684
Domain Number - Region: 2-54
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.045
Family Multidrug-binding domain of transcription activator BmrR 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013057340.1.65684
Sequence length 134
Comment MULTISPECIES: hypothetical protein [Bacillus]; AA=GCF_000514175.1; RF=na; TAX=1286363; STAX=1286363; NAME=Bacillus sp. 171095_106; strain=171095_106; AL=Scaffold; RT=Major
Sequence
MEEKQEIVPVRTEETAKYYSEEKFWDKLKKFGKKAGANVVYAVLLLYYTLQKPDIPPKAK
AVIIGALGYFILPLDLIPDFAAGVGFTDDLGALGLALIQVAMYIDEGVKLKAKEKIKTWF
SEEHNFSIIDAKIK
Download sequence
Identical sequences A0A0B6AHI1 A0A0M0WLI9 A0A0Q6HC30 A0A0Q9GKS9 A0A1Q8TZ07 D5DG74 D5DTL8
WP_013057340.1.11259 WP_013057340.1.12495 WP_013057340.1.12923 WP_013057340.1.17588 WP_013057340.1.18762 WP_013057340.1.30509 WP_013057340.1.44691 WP_013057340.1.53165 WP_013057340.1.61351 WP_013057340.1.64554 WP_013057340.1.65684 WP_013057340.1.71276 WP_013057340.1.77638 WP_013057340.1.91935 WP_013057340.1.92059 WP_013057340.1.94149 gi|294499399|ref|YP_003563099.1| gi|295704750|ref|YP_003597825.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]