SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013061442.1.91540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013061442.1.91540
Domain Number 1 Region: 63-515
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.41e-102
Family Amylase, catalytic domain 0.0000000112
Further Details:      
 
Domain Number 2 Region: 520-620
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.7e-32
Family alpha-Amylases, C-terminal beta-sheet domain 0.0000874
Further Details:      
 
Domain Number 3 Region: 16-108
Classification Level Classification E-value
Superfamily E set domains 7.17e-26
Family E-set domains of sugar-utilizing enzymes 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013061442.1.91540
Sequence length 622
Comment glycogen-branching enzyme [Salinibacter ruber]; AA=GCF_000090405.2; RF=na; TAX=761659; STAX=146919; NAME=Salinibacter ruber M8; strain=M8; AL=Complete Genome; RT=Major
Sequence
MPHLTDDDIYYWRQGTHTHSYERMGAHPNQRGTWFSVWAPNADRVEVTGDFNDWRFGADV
LDRREGGLWEGYVRGAQPGDKYKYHLRADGEWFDRTDPYAFRMEPPAQNTYEGLSALITD
LDTYTWGDDAWMTTREGPSGIDGPLSIYEVHLGSWRHEEHGASLSYREVAEPLADHVQNL
GFTHVEFLPLAEHPYYGSWGYQILGYYAPTFRYGDPEGLMHLIDTLHQRGIGVIMDWVPG
HFATDPQGLTYFDGSHLFEYEDPLMREHPDWGTRVFDFGKNGVRNFLLSNALFWMDKYHV
DGLRVDAVASMLYRDYSREGDWSPNVHGGRENLGAISLLQDTNEHVYDEYPEAIMLAEES
TAWPGVTTPTEHGGLGFLYKWNMGWMHDTLEYASKEPVHRKHHHGDLTWTLSWAFSENYT
LPLSHDEVVHGKNSLWSKMPGDDWQKAANLRLLYAHMFGHPGKKLLFMGGEFGQHREWDH
DRALEWGLADEPLHEGLMEWLGDLNHLYQNAPALWNDQEDGFEWIAYDDRENSVLTYRRL
NGDRSLVFVLNFTPVVREDYRIGATGDGRWHERLNSDSDVYGGSNVGNRGAVHSDPVEKH
GHSHSLSLTLPPLGALVLEPAE
Download sequence
Identical sequences D5H7E5
gi|294506844|ref|YP_003570902.1| WP_013061442.1.91540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]