SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013061506.1.91540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013061506.1.91540
Domain Number 1 Region: 166-295
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 1.52e-35
Family Peptidoglycan hydrolase LytM 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013061506.1.91540
Sequence length 298
Comment peptidase M24 [Salinibacter ruber]; AA=GCF_000090405.2; RF=na; TAX=761659; STAX=146919; NAME=Salinibacter ruber M8; strain=M8; AL=Complete Genome; RT=Major
Sequence
MWSFFADLVQKVGTEQTIVVMDAEGVGKTRRHHVRPSRMVAMWGGSLAAAGLLAALLVAF
TPLRTQIPGYGTEEMKESARLNTLRVRALQDSLAAQRDYIQRLRRLITGRVEPAPPSDGA
RSESGAGGGAVATGEAGPPASEGPSGASARNAHQQPAFAPSPRSGATASAPGGLSFPLSP
PVANGFPTRGFDVATGHYGIDVAVSEGDYVRSVGDGYVVWADWAQDGGYTIAVQHAGGYL
SVYKHNKRLLKQLGDRVTAQEPVAVTGNTGAVTTGPHLHFELWQNGLAQGPDAYIAGW
Download sequence
Identical sequences D5H7L6
WP_013061506.1.91540 gi|294506915|ref|YP_003570973.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]