SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013062611.1.91540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013062611.1.91540
Domain Number 1 Region: 124-536
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.43e-92
Family Amylase, catalytic domain 0.00000000529
Further Details:      
 
Domain Number 2 Region: 24-114
Classification Level Classification E-value
Superfamily E set domains 1.15e-25
Family E-set domains of sugar-utilizing enzymes 0.00083
Further Details:      
 
Domain Number 3 Region: 538-614
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 3.12e-16
Family alpha-Amylases, C-terminal beta-sheet domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013062611.1.91540
Sequence length 616
Comment glycosyl hydrolase [Salinibacter ruber]; AA=GCF_000090405.2; RF=na; TAX=761659; STAX=146919; NAME=Salinibacter ruber M8; strain=M8; AL=Complete Genome; RT=Major
Sequence
MRRLLAAVLLLLACPALVLAQAPEIDRIDPPFWWVDMERPTVELMVYGENLATTRVEIGT
HPGVTLDRVTEVENPNYLFVRLRIGDAATPGTIPLHFRHDAGTLTRDFELRPRRTGTYAQ
GFSSEDVIYLLMPDRFANGAPENDSIPGFLEGVDRSDPDARHGGDFAGVREHLDYIDDLG
MTALWMTPIFENDMPPEYGAYHGYAATDMYRVDPRFGSNDMFRRLVESAHERDLKVIMDM
IHNHIGDRHWWMDDPPTGDWVHDFDKYGTTNYEGAAVIDPYAAGHDREQLTDAWFVPSMP
DLNQDNELLATYLIQNTLWWIESTGIDGIRMDTYFYADKDYMTRWTSAVLEEYPDFNIVG
ESWVPTVPHEAYWQDDFQAHPDDYDSDLPSVTDFPLSFAMQDAFAPDGGGVYDLYRTLAQ
DHVYPAPNKLVTFLDNHDLTRLFSVVDEDEDAFKLAYAFLMTTRGIPQVYYATELMQPML
DVEGDGAKRPDMPGGWPGDARSVFTEEGRTARENRAHDFVTTLTTWREDADVVHHGGLTH
YIPQDNTYVYFRHDADDTVMVVLNNAEESRTLALDRFEERIQGHTAGRDVISGATVALGD
SLTVPARTPMVLELRK
Download sequence
Identical sequences D5HBZ5
WP_013062611.1.91540 gi|294508444|ref|YP_003572502.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]